General Information

  • ID:  hor001886
  • Uniprot ID:  P41534
  • Protein name:  Growth hormone-releasing factor 1-46
  • Gene name:  ADCYAP1
  • Organism:  Gallus gallus (Chicken)
  • Family:  Glucagon family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Gallus (genus), Phasianinae (subfamily), Phasianidae (family), Galliformes (order), Galloanserae (superorder), Neognathae (infraclass), Aves (class), Coelurosauria, Theropoda, Saurischia, Dinosauria, Archosauria, Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0016521 pituitary adenylate cyclase activating polypeptide activity; GO:0051428 peptide hormone receptor binding
  • GO BP:  GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0007218 neuropeptide signaling pathway; GO:0010628 positive regulation of gene expression; GO:0030073 insulin secretion; GO:0031175 neuron projection development; GO:0032880 regulation of protein localization; GO:0045944 positive regulation of transcription by RNA polymerase II; GO:0060124 positive regulation of growth hormone secretion; GO:0070374 positive regulation of ERK1 and ERK2 cascade
  • GO CC:  GO:0005576 extracellular region; GO:0043005 neuron projection; GO:0043204 perikaryon; GO:0044297 cell body; GO:0070852 cell body fiber

Sequence Information

  • Sequence:  HADGIFSKAYRKLLGQLSARNYLHSLMAKRVGGASSGLGDEAEPLS
  • Length:  46
  • Propeptide:  MSGNVYKTLLTLLVYGLIMHCNVYCSPDRWTPVPGAKLEEEVYDEDGNTLQDFALRAGAPGGGGPRPRWGRCTALYYPPGKRHADGIFSKAYRKLLGQLSARNYLHSLMAKRVGGASSGLGDEAEPLSKRHIDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRVAYL
  • Signal peptide:  MSGNVYKTLLTLLVYGLIMHCNV
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Release GH from the pituitary
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q5H8A1-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-Q5H8A1-F1.pdbhor001886_AF2.pdbhor001886_ESM.pdb

Physical Information

Mass: 567638 Formula: C213H344N64O65S
Absent amino acids: CTW Common amino acids: L
pI: 9.86 Basic residues: 8
Polar residues: 15 Hydrophobic residues: 16
Hydrophobicity: -28.7 Boman Index: -6942
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 87.17
Instability Index: 2038.7 Extinction Coefficient cystines: 2980
Absorbance 280nm: 66.22

Literature

  • PubMed ID:  NA
  • Title:  NA